Released on: September 14, 2007, 2:59 pm

Press Release Author: AnaSpec Inc.

Industry: Biotech

Press Release Summary: AnaSpec, one of the world's largest providers of custom and
catalog peptides, introduced thirty-two (32) new peptides for drug discovery
research.

Press Release Body: September 13, 2007 - San Jose, CA

Today AnaSpec, one of the world's largest providers of custom and catalog peptides,
introduced thirty-two (32) new peptides for drug discovery research.

Beta-Amyloid A4 Protein Precursor (740-770); APP (C31) - Cat# 62073
This 31-amino acid peptide C31 corresponds to the C-terminal fragment of the Amyloid
Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the
generation of C31 may be involved in the neuronal death associated with Alzheimer
disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is
located in lipid rafts together with the APP-BP1; a binding protein for the
intracellular domain of APP.
Sequence: AAVTPEERHLSKMQQNGYENPTYKFFEQMQN

Amyloid Precursor Protein (APP) (667-676) - Cat# 62065
This amyloid precursor protein fragment amino acid residues 667 to 676 is a beta
secretase substrate. This peptide may be also cleaved by Beta-site APP cleavage
enzyme (BACE) between Met and Asp residues; and by the enzyme thimet oligopeptidase
(TOP).
Sequence: SEVKMDAEFR

Amyloid Precursor Protein (APP) (667-676); Dnp-labeled - Cat# 62074
This amyloid precursor protein fragment amino acid residues 667 to 676 is a beta
secretase substrate labeled with DAP(Dnp). This peptide may be used in beta
secretase activity assays.
Sequence: SEVKMDAEFR-DAP(DNP)-KK

[Ala10]-beta-Amyloid (1-10) - Cat# 62131
This is the N-terminal fragment of the b-Amyloid peptide; residues 1 to 10; modified
with alanine substitution at position 10.
Sequence: DAEFRHDSGA-NH2

[Cys9]-beta-Amyloid (1-9) - Cat# 62132
This is the N-terminal fragment of the b-Amyloid peptide; residues 1 to 8; with
cysteine coupled at position 9. A cysteine residue is coupled to the b-Amyloid
peptide for antibody development purposes.
Sequence: DAEFRHDSC

Beta-Amyloid (16-20) M - Cat# 61344
This membrane permeable N-methyl amino acid-containing peptide inhibits b-amyloid 1
to 40 fibrillogenesis. Its structure is remarkably stable to changes in solvent
conditions and resists denaturation by heating; changes in pH (from 2.5 to 10.5);
and addition of denaturants such as urea and guanindine-HCl. The striking water
solubility; in combination with the hydrophobic composition of the peptide; allows
the peptide to pass spontaneously through cell membranes.
Sequence: Ac-K(Me)-L-(N-Me-V)-FF-NH2

Beta-Amyloid (14-23) - Cat# 62024
This sequence is crucial for fibril formation of the full-length beta -Amyloid
peptides. beta -Amyloid 14 to 23 fibrils contain antiparallel beta-sheets with a
registry of backbone hydrogen bonds that connects residue 17+k of each peptide
molecule with residue 22-k of neighboring molecules in the same beta-sheet. In
general; beta sheets involving the peptides with this essential fragment sequence
strongly prefer the anti-parallel topology.
Sequence: HQKLVFFAED

Beta-Amyloid (1-16); Lys16(HiLyte Fluor TM 488) - Cat# 62002-05
This peptide is the b-Amyloid peptide; residues 1 to 16 labeled with HiLyte Fluor TM
488 on the Lys16; Abs/Em =501/527.
Sequence: DAEFRHDSGYEVHHQ-K(HiLyte Fluor 488)

Beta-Amyloid (15-36) - Cat# 62023
This is a fragment of beta-amyloid peptide amino acids 15 to 36. As a part of the
full length b-amyloid peptide; fragment 15 to 36 adopts an alpha-helical
conformation between these 15 and 36 residues with a kink or hinge at 25 to 27
according to some authors; and 15 to 20 and 24 to 34 by others.
Sequence: QKLVFFAEDVGSNKGAIIGLMV

[Cys58]105Y; Cell Penetrating Peptide; ?1-antitrypsin (358-374) - Cat# 62005
This is a synthetic peptide based on the sequence corresponding to residues 359 to
374 of ?1-antitrypsin. C105Y can penetrate cell membrane rapidly; enter the
cytoplasm; and localize to the nucleus and nucleolus of live culture cells. C105Y
peptide is routed to the nucleolus very rapidly in an energy-dependent fashion;
whereas membrane translocation and nuclear localization are energy-independent. It
enhances gene expression from DNA nanoparticles.
Sequence: CSIPPEVKFNKPFVYLI

GRP10; Gastrin-releasing Peptide 10 / Neuromedin C; amidated - Cat# 62095
This sequence is shared by the Gastrin-releasing peptide (GRP) and / Neuromedin C
fragments. GRP is a small; naturally occurring bombesin-like peptide. Isolated from
canine antral muscle; this peptide was also used as a part of the antigen-antibody
complex to rapidly identify antigenic determinants (epitopes).
Sequence: GNHWAVGHLM-NH2

M1128; Viral Matrix Protein (128-135) - Cat# 62031
This peptide is a matrix protein fragment; residues 128 to 135; a Kb-restricted
epitope M1128. This peptide binds Kb with high affinity and induces CTLs that
effectively recognize influenza PR8-infected cells.
Sequence: MGLIYNRM

R18 Peptide - Cat# 62160
R18 is a peptide that specifically binds to 14-3-3 proteins without isoform
selectivity. 14-3-3 proteins are known to regulate a variety of different cellular
processes; such as cell division; apoptosis; signaling; carbon and nitrogen
metabolism. They were the first proteins recognized to specifically bind a discrete
phosphoserine or phosphothreonine motif. 14-3-3 proteins belong to a conserved
protein family consisting of seven isoforms in human; two isoforms in yeast
(Saccharomyces cerevisiae); 15 isoforms in Arabidopsis (Arabidopsis thaliana); and
eight isoforms in rice.
Sequence: PHCVPRDLSWLDLEANMCLP

RIAD; FAM labeled - Cat# 62018
This cell-soluble high affinity-binding peptide; the RI anchoring disruptor (RIAD)
selectively uncouples cAMP-mediated inhibition of T cell function and inhibits
progesterone synthesis at the mitochondria in steroid-producing cells. These
processes are controlled by the type I PKA holoenzyme and RIAD; and can be used as a
tool to define anchored type I PKA signaling events.
Sequence: LEQYANQLADQIIKEATE-K(FAM)-NH2

PKC zeta 410 - Cat# 62025
PKC-zeta is a critical mediator of mitogenic signaling in many cell types; mediating
angiotensin II-induced activation of extracellular signal-regulated kinases (ERK)
and cell proliferation in vascular smooth muscle cells; insulin-induced ERK
activation in adipocytes. PKC-z is mediated by phosphorylation at its T-loop site by
3-phosphoinositide-dependent protein kinase-1 (PDK1) followed by
autophosphorylation. PDK-1 and its downstream target; Thr-410 in the activation loop
of PKC-z is required for insulin-stimulated glucose transport. PKC-z also mediates
phospholipase D activation.
Sequence: GDTTSTFCGTPN

Heat Shock Protein 65 (458-474); human - Cat# 62035
This sequence is a T-cell epitope of hsp65; 65-kDa heat shock protein molecule
fragment. This peptide is important in pathogenesis of diabetes. Diabetogenic T-cell
clones recognizing this peptide mediate insulitis and hyperglycemia.
Sequence: NEDQKIGIEIIKRTLKI

Obestatin (11-23); human - Cat# 62041
This peptide is 11 to 23 amino acids fragment of the rat and mouse obestatin
peptide. Derived from the ghrelin gene; obestatin peptide suppresses food intake;
inhibits jejunal contraction; and decreases body-weight gain. Obestatin was thought
to bind to the orphan G protein-coupled receptor GPR39; however new data confirm
that I125-obestatin does not bind GPR39.
Sequence: LSGVQYQQHSQAL

PyCSP (57-70) Plasmodium Yoelii Circumsporozoite Protein (57-70) - Cat# 62130
This peptide causes CD4+ T cell proliferation and cytokine responses. P. Yoelii (Py)
infects laboratory mice and has provided a useful model for studying antimalarial
immunity. This peptide was used in the malaria vaccine development studies.
Sequence: KIYNRNIVNRLLGD

Cathepsin D substrate; fluorogenic - Cat# 61860-05
This is the peptide substrate for cathepsin D; a lysosomal aspartic proteinase that
has been implicated in several pathological processes such as breast cancer and
Alzheimer\'s disease; Abs/Em=335/493 nm.
Sequence: Ac-E-D(edans)-KPILFFRLG-K(dabcyl)-E-NH2

EYK(EYA)3EYK - Cat# 62218
This synthetic polypeptide is a critical residue in P18 sequence required for Ag/I-
Ad induced activation of T cell hybridoma A.1.1. It was positively tested for its
ability to act as a target for the A.1.1-derived suppressive activity when
conjugated to SRBC (sheep erythrocyte).
Sequence: EYKEYAEYAEYAEYK

PDGF-BB peptide - Cat# 62192
This Platelet-derived Growth Factor-BB (PDGF-BB) peptide fragment was used in the
stellate cells research. PDGF is a dimeric peptide composed of two closely related;
but not identical chains; A and B; which are linked by disulfide bonds. PDGF
regulates its biological functions through its binding to specific high-affinity
receptors on cell surface. The PDGF alpha-receptor binds PDGF-AA and PDGF-BB;
whereas the Beta-receptor (PDGFR-beta) binds PDGF-BB only. PDGF is one of the growth
factors that regulates cell growth and division.
Sequence: CSRNLIDC (S-S BONDED)

Alpha-Myosin (735-747) - Cat# 62124
This peptide belongs to the cardiac a-myosin amino acid residues 735 to 747.
Immunization with cardiac myosin induces T cell-mediated myocarditis in genetically
predisposed mice and serves as a model for autoimmune heart disease.
Sequence: GQFIDSGKAGAEKL

Alpha-Myosin (947-960) - Cat# 62125
This peptide belongs to the cardiac Alpha-myosin amino acid residues 947 to 960.
Immunization with cardiac myosin induces T cell-mediated myocarditis in genetically
predisposed mice and serves as a model for autoimmune heart disease. Myocarditis
induced by this a-myosin peptide was restricted to foci of interstitial
infiltration.
Sequence: DECSELKKDIDDLE

Alpha-Myosin (614-643) - Cat# 62126
This peptide belongs to the acetylated cardiac alpha-myosin amino acid residues 614
to 643. Immunization with cardiac myosin induces T cell-mediated myocarditis in
genetically predisposed mice and serves as a model for autoimmune heart disease. The
nonacetylated variant of this dominant peptide corresponding to amino acids 614 to
643 fails to induce the disease. N-terminal acetylation significantly changes the
pathogenicity of the peptides. This acetylated form of the peptide shows dominant
pathogenicity and induces severe myocarditis with inflammatory lesions throughout
the ventricular wall.
Sequence: Ac-SLKLMATLFSTYASADTGDSGKGKGGKKKG

Alpha-Myosin (614-643) Modified - Cat# 62127
This peptide belongs to the modified acetylated cardiac alpha-myosin. Immunization
with cardiac alpha-myosin induces T cell-mediated myocarditis in genetically
predisposed mice and serves as a model for autoimmune heart disease. Alpha-Myosin is
the immunodominant isoform and induces myocarditis at high severity and prevalence
whereas beta-myosin and modified alpha-myosin do not.
Sequence: Ac-SLKLLSNLFANYAGADTAPVDKGKGKAKKG

Apidaecin IA - Cat# 62045
Apidaecin IA is unique antibacterial peptide derivative found in immune honey bee
lymph. Apidaecins; the most prominent components of the honey bee humoral defense
against microbial invasion; are a series of small; proline-rich 18- to 20-residue
peptides. They inhibit viability of Gram-negative bacteria; with lethal activity
near immediate; independent of a conventional \'lytic\' mechanism; and involves
stereoselective recognition of target molecules.
Sequence: GNNRPVYIPQPRPPHPRI

Andropin - Cat# 62046
Andropin; which encodes an antibacterial protein; shows no direct homology with most
cecropins; but is closely linked to the Cecropin gene cluster of D. melanogaster.
Sequence: VFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK

Apidaecin IB - Cat# 62044
Apidaecin IB is an insect antimicrobial peptide showing a significant sequence
homology and a common mechanism of action with drosocin; but is devoid of any
pore-forming activity. Apidaecins are the most prominent components of the honey bee
humoral defense against microbial invasion.
Sequence: GNNRPVYIPQPRPPHPRL

VEGFR-2/KDR I; murine - Cat# 62090
This peptide is the murine Vascular Endothelial Growth Factor Receptor
2(VEGFR-2)/KDR fragment I that binds murine MHC Class I molecules and elicits an
anti-angiogenic immune response. It is an angiogenesis inhibitor. VEGFR2/KDR plays a
crucial role in tumor-associated angiogenesis and vascularization. Immunization with
this peptide effectively reduces angiogenesis and inhibits tumor growth in mouse
models.
Sequence: FSNSTNDILI

TP53 Q9NP68; p53 Mutant Form (361-377); Lys371 (Ac) - Cat# 62121
This peptide is derived from the tumor suppressor p53 mutant with the acetylated Lys
on the side chain.
Sequence: KKGQSTSRHK-K(Ac)-LMFKTEG

Bid BH3-R9 - Cat# 62057
Tagging peptides with a poly-D-arginine tag facilitates cell internalization in
vitro and in vivo. Poly-D-arginine was tagged to the Bid BH3; which is a
pro-apoptotic member of the \'BH3-only\' subset of the BCL-2 family proteins that
constitute a critical control point in apoptosis.
Sequence: RRRRRRRRGEDIIRNIARHLAQVGDSMDR

Bak-BH3 peptide; Mca labeled - Cat# 62029
This peptide is derived from the BH3 domain of Bak (Flu-BakBH3).It has high-affinity
binding to a surface pocket of the Bcl-XL protein that is essential for its death
antagonist function. This peptide is labeled with MCA
(7-methoxycoumarine-4-yl)acetyl on the N-terminus; Abs/Em=325/393 nm.
Sequence: 7-methoxycoumarine-4-yl acetyl (Mca)-GQVGRQLAIIGDDINR

Company Info
AnaSpec, Inc. is a leading provider of integrated proteomics solutions to
pharmaceutical, biotech, and academic research institutions throughout the world.
With a vision for innovation through synergy, AnaSpec focuses on three core
technologies: peptides, detection reagents, and combinatorial chemistry.
Established in 1993, AnaSpec\'s headquarters and manufacturing facilities are located
in San Jose, CA.

For more information visit www.anaspec.com


Web Site: http://www.anaspec.com

Contact Details: 2149 O\'Toole Ave.
San Jose, CA 95131
ping@anaspec.com